Recombinant Human GPHA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GPHA2-2867H
• Product Overview: GPHA2 MS Standard C13 and N15-labeled recombinant protein (NP_570125) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: GPHA2 is a cystine knot-forming polypeptide and a subunit of the dimeric glycoprotein hormone family.
• Molecular Mass: 14.2 kDa
• AA Sequence: MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GPHA2 glycoprotein hormone alpha 2 [ Homo sapiens (human) ]
• Official Symbol: GPHA2
• Synonyms: GPHA2; glycoprotein hormone alpha 2; glycoprotein hormone alpha-2; A2; cysteine knot protein; glycoprotein alpha 2; GPA2; MGC126572; ZSIG51; thyrostimulin subunit alpha; putative secreted protein Zsig51
• Gene ID: 170589
• mRNA Refseq: NM_130769
• Protein Refseq: NP_570125
• MIM: 609651
• UniProt ID: Q96T91