Recombinant Human GPER1 protein, GST-tagged
Cat.No. : | GPER1-12H |
Product Overview : | Recombinant Human GPER1(1 a.a. - 375 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-375 a.a. |
Description : | This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 68.6 kDa |
AA Sequence : | MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GPER1 G protein-coupled estrogen receptor 1 [ Homo sapiens ] |
Official Symbol | GPER1 |
Synonyms | mER; CEPR; GPER; DRY12; FEG-1; GPR30; LERGU; LyGPR; CMKRL2; LERGU2; GPCR-Br; G protein-coupled receptor 30; IL8-related receptor DRY12; chemoattractant receptor-like 2; chemokine receptor-like 2; constitutively expressed peptide-like receptor; flow-induced endothelial G-protein coupled receptor 1; heptahelix receptor; leucine rich protein in GPR30 3'UTR; lymphocyte-derived G-protein coupled receptor; membrane estrogen receptor |
Gene ID | 2852 |
mRNA Refseq | NM_001505 |
Protein Refseq | NP_001496 |
MIM | 601805 |
UniProt ID | Q99527 |
Chromosome Location | 7p22.3 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Estrogen signaling pathway, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem |
Function | G-protein coupled receptor activity; mineralocorticoid receptor activity; protein binding |
◆ Recombinant Proteins | ||
GPER-2983HCL | Recombinant Human GPER1 Over-expression Lysate, C-Myc/DDK tagged | +Inquiry |
GPER1-3969C | Recombinant Chicken GPER1 | +Inquiry |
GPER1-6999Z | Recombinant Zebrafish GPER1 | +Inquiry |
GPER1-01HCL | Recombinant Human GPER1 Over-expression Lysate, C-Myc/DDK tagged | +Inquiry |
RFL25114RF | Recombinant Full Length Rat G-Protein Coupled Estrogen Receptor 1(Gper) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPER1 Products
Required fields are marked with *
My Review for All GPER1 Products
Required fields are marked with *
0
Inquiry Basket