Recombinant Human GPER1 protein, GST-tagged

• Cat.No.: GPER1-12H
• Product Overview: Recombinant Human GPER1(1 a.a. - 375 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-375 a.a.
• Description: This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 68.6 kDa
• AA Sequence: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: GPER1 G protein-coupled estrogen receptor 1 [ Homo sapiens ]
• Official Symbol: GPER1
• Synonyms: mER; CEPR; GPER; DRY12; FEG-1; GPR30; LERGU; LyGPR; CMKRL2; LERGU2; GPCR-Br; G protein-coupled receptor 30; IL8-related receptor DRY12; chemoattractant receptor-like 2; chemokine receptor-like 2; constitutively expressed peptide-like receptor; flow-induced endothelial G-protein coupled receptor 1; heptahelix receptor; leucine rich protein in GPR30 3'UTR; lymphocyte-derived G-protein coupled receptor; membrane estrogen receptor
• Gene ID: 2852
• mRNA Refseq: NM_001505
• Protein Refseq: NP_001496
• MIM: 601805
• UniProt ID: Q99527
• Chromosome Location: 7p22.3
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Estrogen signaling pathway, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem
• Function: G-protein coupled receptor activity; mineralocorticoid receptor activity; protein binding