Recombinant Human GP1BA protein, His&Myc-tagged

Cat.No. : GP1BA-2984H
Product Overview : Recombinant Human GP1BA protein(P07359)(553-652aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 553-652aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 15.9 kDa
AA Sequence : SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name GP1BA glycoprotein Ib (platelet), alpha polypeptide [ Homo sapiens ]
Official Symbol GP1BA
Synonyms GP1BA; glycoprotein Ib (platelet), alpha polypeptide; GP1B; platelet glycoprotein Ib alpha chain; CD42b; GP-Ib alpha; antigen CD42b-alpha; platelet membrane glycoprotein 1b-alpha subunit; BSS; VWDP; CD42B; GPIbA; BDPLT1; BDPLT3; DBPLT3; CD42b-alpha; MGC34595;
Gene ID 2811
mRNA Refseq NM_000173
Protein Refseq NP_000164
MIM 606672
UniProt ID P07359

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GP1BA Products

Required fields are marked with *

My Review for All GP1BA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon