Recombinant Human GP1BA protein, His&Myc-tagged

• Cat.No.: GP1BA-2984H
• Product Overview: Recombinant Human GP1BA protein(P07359)(553-652aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 553-652aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 15.9 kDa
• AA Sequence: SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GP1BA glycoprotein Ib (platelet), alpha polypeptide [ Homo sapiens ]
• Official Symbol: GP1BA
• Synonyms: GP1BA; glycoprotein Ib (platelet), alpha polypeptide; GP1B; platelet glycoprotein Ib alpha chain; CD42b; GP-Ib alpha; antigen CD42b-alpha; platelet membrane glycoprotein 1b-alpha subunit; BSS; VWDP; CD42B; GPIbA; BDPLT1; BDPLT3; DBPLT3; CD42b-alpha; MGC34595
• Gene ID: 2811
• mRNA Refseq: NM_000173
• Protein Refseq: NP_000164
• MIM: 606672
• UniProt ID: P07359