Recombinant Human GOPC Protein, His-tagged

• Cat.No.: GOPC-5118H
• Product Overview: Human GOPC (NP_001017408, 278 a.a. - 454 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 278-454 a.a.
• Description: PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM
• Form: Liquid
• Molecular Mass: 21.5 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 1 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol)

Gene Information

• Gene Name: GOPC golgi-associated PDZ and coiled-coil motif containing [ Homo sapiens ]
• Official Symbol: GOPC
• Synonyms: GOPC; golgi-associated PDZ and coiled-coil motif containing; Golgi-associated PDZ and coiled-coil motif-containing protein; CAL; dJ94G16.2; FIG; GOPC1; PIST; dJ94G16.2 PIST; fused in glioblastoma; CFTR-associated ligand; PDZ protein interacting specifically with TC10; Golgi associated PDZ and coiled-coil motif containing protein; PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10
• Gene ID: 57120
• mRNA Refseq: NM_001017408
• Protein Refseq: NP_001017408
• MIM: 606845
• UniProt ID: Q9HD26