Recombinant Human GOLM1 Protein, GST-tagged

Cat.No. : GOLM1-5112H
Product Overview : Human GOLM1 partial ORF ( NP_057632, 302 a.a. - 401 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GOLM1 golgi membrane protein 1 [ Homo sapiens ]
Official Symbol GOLM1
Synonyms GOLM1; golgi membrane protein 1; C9orf155, chromosome 9 open reading frame 155, golgi phosphoprotein 2, GOLPH2; Golgi membrane protein 1; bA379P1.3; FLJ23608; GP73; golgi protein, 73-kD; golgi phosphoprotein 2; golgi membrane protein GP73; GOLPH2; C9orf155; PSEC0257; FLJ22634;
Gene ID 51280
mRNA Refseq NM_016548
Protein Refseq NP_057632
MIM 606804
UniProt ID Q8NBJ4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GOLM1 Products

Required fields are marked with *

My Review for All GOLM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon