Recombinant Human GOLM1 Protein, GST-tagged

• Cat.No.: GOLM1-5112H
• Product Overview: Human GOLM1 partial ORF ( NP_057632, 302 a.a. - 401 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GOLM1 golgi membrane protein 1 [ Homo sapiens ]
• Official Symbol: GOLM1
• Synonyms: GOLM1; golgi membrane protein 1; C9orf155, chromosome 9 open reading frame 155, golgi phosphoprotein 2, GOLPH2; Golgi membrane protein 1; bA379P1.3; FLJ23608; GP73; golgi protein, 73-kD; golgi phosphoprotein 2; golgi membrane protein GP73; GOLPH2; C9orf155; PSEC0257; FLJ22634
• Gene ID: 51280
• mRNA Refseq: NM_016548
• Protein Refseq: NP_057632
• MIM: 606804
• UniProt ID: Q8NBJ4