Recombinant Human GOLGB1 Protein, GST-tagged

• Cat.No.: GOLGB1-5111H
• Product Overview: Human GOLGB1 partial ORF ( NP_004478, 3 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GOLGB1 (Golgin B1) is a Protein Coding gene. Diseases associated with GOLGB1 include Blue Cone Monochromacy and Pedophilia. Among its related pathways are Clathrin derived vesicle budding and Vesicle-mediated transport. GO annotations related to this gene include poly(A) RNA binding and sequence-specific DNA binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.53 kDa
• AA Sequence: SRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GOLGB1 golgin B1 [ Homo sapiens ]
• Official Symbol: GOLGB1
• Synonyms: GOLGB1; golgin B1; golgi autoantigen, golgin subfamily b, macrogolgin (with transmembrane signal), 1, golgin B1, golgi integral membrane protein; Golgin subfamily B member 1; GCP; GCP372; giantin; golgi integral membrane protein 1; GOLIM1; macrogolgin; 372 kDa Golgi complex-associated protein; golgin B1, golgi integral membrane protein; golgi autoantigen, golgin subfamily b, macrogolgin (with transmembrane signal), 1; FLJ37232; DKFZp686F09142
• Gene ID: 2804
• mRNA Refseq: NM_001256487
• Protein Refseq: NP_001243416
• MIM: 602500
• UniProt ID: Q14789