Recombinant Human GOLGA7 Protein, GST-tagged

• Cat.No.: GOLGA7-5110H
• Product Overview: Human GOLGA7 full-length ORF ( AAH12032, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GOLGA7 (Golgin A7) is a Protein Coding gene. Among its related pathways are Innate Immune System. An important paralog of this gene is GOLGA7B.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 40.81 kDa
• AA Sequence: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GOLGA7 golgin A7 [ Homo sapiens ]
• Official Symbol: GOLGA7
• Synonyms: GOLGA7; golgin A7; golgi autoantigen, golgin subfamily a, 7; Golgin subfamily A member 7; GCP16; GOLGA3AP1; GOLGA7A; HSPC041; Golgi complex-associated protein of 16kDa; golgi complex-associated protein of 16 kDa; MGC4876; MGC21096
• Gene ID: 51125
• mRNA Refseq: NM_001002296
• Protein Refseq: NP_001002296
• MIM: 609453
• UniProt ID: Q7Z5G4