Recombinant Human GMFG Protein, GST-tagged

Cat.No. : GMFG-5011H
Product Overview : Human GMFG full-length ORF ( NP_004868.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GMFG (Glia Maturation Factor Gamma) is a Protein Coding gene. Among its related pathways are GPCR Pathway and Phospholipase-C Pathway. GO annotations related to this gene include actin binding and enzyme activator activity. An important paralog of this gene is GMFB.
Molecular Mass : 43.2 kDa
AA Sequence : MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GMFG glia maturation factor, gamma [ Homo sapiens ]
Official Symbol GMFG
Synonyms GMFG; glia maturation factor, gamma; glia maturation factor gamma; GMF-GAMMA; MGC126867;
Gene ID 9535
mRNA Refseq NM_004877
Protein Refseq NP_004868
MIM 604104
UniProt ID O60234

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GMFG Products

Required fields are marked with *

My Review for All GMFG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon