Recombinant Human Glutaredoxin 2, His-tagged
Cat.No. : | GLRX2-1828H |
Product Overview : | Recombinant human Glutaredoxin 2, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Glutaredoxin-2, as known as GRX2, multifunctional enzyme with glutathione-dependent oxidoreductase, glutathione peroxidase and glutathione S-transferase(GST) activity. This protein is localized both in the mitochondria and nucleus. It has anti-apoptotic activity by preventing cardiolipin oxidation and cytochrome c release. GRX2 exhibited 36% identity with GRX1 and had a disulfide active center containing the Cys-Ser-Tyr-Cys motif. |
Sequences of amino acids : | MSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNC VVIFSK TSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTF I GGATDTH RLHKEGKLLP LVHQCYLKKS KRKEFQLEHH HHHH |
Form : | Liquid. In 20 mM Tris-HCl Buffer (pH 8.0) containing 0.1 mM PMSF, 10% Glycerol |
Molecular Weight : | 17.0 kDa (154aa) |
Purity : | > 90% by SDS - PAGE |
Concentration : | 0.5 mg/ml (determined by Bradford assay) |
Storage : | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Gene Name | GLRX2 glutaredoxin 2 [ Homo sapiens ] |
Synonyms | GLRX2; GRX2; bA101E13.1; bA101E13.1; glutaredoxin 2; bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2); OTTHUMP00000033766; OTTHUMP00000033767; bA101E13.1; glutaredoxin 2. |
Gene ID | 51022 |
mRNA Refseq | NM_016066 |
Protein Refseq | NP_057150 |
MIM | 606820 |
UniProt ID | Q9NS18 |
Chromosome Location | 1q31.2-q31.3 |
Function | 2 iron, 2 sulfur cluster binding; arsenate reductase (glutaredoxin) activity; electron carrier activity; glutathione disulfide oxidoreductase activity; iron ion binding; metal ion binding; protein disulfide oxidoreductase activity |
◆ Recombinant Proteins | ||
GLRX2-27694TH | Recombinant Human GLRX2, His-tagged | +Inquiry |
GLRX2-5547H | Recombinant Human GLRX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GLRX2-550C | Recombinant Cynomolgus GLRX2 Protein, His-tagged | +Inquiry |
GLRX2-1875R | Recombinant Rhesus monkey GLRX2 Protein, His-tagged | +Inquiry |
GLRX2-541Z | Recombinant Zebrafish GLRX2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX2-714HCL | Recombinant Human GLRX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLRX2 Products
Required fields are marked with *
My Review for All GLRX2 Products
Required fields are marked with *
0
Inquiry Basket