Recombinant Human GLS protein, GST-tagged

• Cat.No.: GLS-2971H
• Product Overview: Recombinant Human GLS protein(O94925)(616-669aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 616-669aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.3 kDa
• AA Sequence: KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GLS glutaminase [ Homo sapiens ]
• Official Symbol: GLS
• Synonyms: GLS; glutaminase; glutaminase kidney isoform, mitochondrial; GLS1; KIAA0838; K-glutaminase; glutaminase C; L-glutamine amidohydrolase; glutaminase, phosphate-activated; GAC; GAM; KGA; AAD20; FLJ10358; FLJ41499; DKFZp686D14231; DKFZp686O15119
• Gene ID: 2744
• mRNA Refseq: NM_001256310
• Protein Refseq: NP_001243239
• MIM: 138280
• UniProt ID: O94925