Recombinant Human GLRA1

• Cat.No.: GLRA1-27289TH
• Product Overview: Recombinant fragment of Human alpha 1 Glycine Receptor (amino acids 121-220) with N terminal proprietary tag, 36.63kDa.

Specification

• Description: The protein encoded by this gene is a subunit of a pentameric inhibitory glycine receptor. The receptor mediates postsynaptic inhibition in the central nervous system. Defects in this gene are a cause of startle disease (STHE), also known as hereditary hyperekplexia or congenital stiff-person syndrome. Two transcript variants encoding different isoforms have been found for this gene.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE
• Sequence Similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA1 sub-subfamily.
• Tag: Non

Gene Information

• Gene Name: GLRA1 glycine receptor, alpha 1 [ Homo sapiens ]
• Official Symbol: GLRA1
• Synonyms: GLRA1; glycine receptor, alpha 1; glycine receptor, alpha 1 (startle disease/hyperekplexia) , STHE; glycine receptor subunit alpha-1; startle disease/hyperekplexia; stiff person syndrome
• Gene ID: 2741
• mRNA Refseq: NM_000171
• Protein Refseq: NP_000162
• MIM: 138491
• Uniprot ID: P23415
• Chromosome Location: 5q31-q33
• Pathway: Ion channel transport, organism-specific biosystem; Ligand-gated ion channel transport, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Transmembrane transport of small molecules, organism-specific biosystem
• Function: extracellular ligand-gated ion channel activity; extracellular-glycine-gated chloride channel activity; contributes_to extracellular-glycine-gated chloride channel activity; extracellular-glycine-gated chloride channel activity; glycine binding