Description :	This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	34.21 kDa
AA Sequence :	NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	GLIPR1 GLI pathogenesis-related 1 [ Homo sapiens ]
Official Symbol	GLIPR1
Synonyms	GLIPR1; GLI pathogenesis-related 1; GLI pathogenesis related 1 (glioma); glioma pathogenesis-related protein 1; GliPR; RTVP1; gliPR 1; protein RTVP-1; GLI pathogenesis-related 1 (glioma); testes-specific vespid and pathogenesis protein 1; related to testis-specific, vespid, and pathogenesis proteins 1; GLIPR; CRISP7;
Gene ID	11010
mRNA Refseq	NM_006851
Protein Refseq	NP_006842
MIM	602692
UniProt ID	P48060