Recombinant Human GLE1

Cat.No. : GLE1-29066TH
Product Overview : Recombinant fragment corresponding to amino acids 140-240 of Human GLE1 with an N terminal proprietary tag; Predicted MWt 36.74 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 101 amino acids
Description : This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.740kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELK QHKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLK LREAEQQRVKQAEQERLRKEE
Sequence Similarities : Belongs to the GLE1 family.
Gene Name GLE1 GLE1 RNA export mediator homolog (yeast) [ Homo sapiens ]
Official Symbol GLE1
Synonyms GLE1; GLE1 RNA export mediator homolog (yeast); GLE1 (yeast homolog) like, RNA export mediator , GLE1 RNA export mediator (yeast) , GLE1 RNA export mediator like (yeast) , GLE1L, LCCS1, lethal congenital contracture syndrome 1; nucleoporin GLE1; hGLE1;
Gene ID 2733
mRNA Refseq NM_001003722
Protein Refseq NP_001003722
MIM 603371
Uniprot ID Q53GS7
Chromosome Location 9q34.13

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GLE1 Products

Required fields are marked with *

My Review for All GLE1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon