Recombinant Human GJB4 Protein, GST-tagged

• Cat.No.: GJB4-4931H
• Product Overview: Human GJB4 full-length ORF ( AAH34709, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations in this gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. [provided by RefSeq, Dec 2009]
• Molecular Mass: 55.00 kDa
• AA Sequence: MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GJB4 gap junction protein, beta 4, 30.3kDa [ Homo sapiens ]
• Official Symbol: GJB4
• Synonyms: GJB4; gap junction protein, beta 4, 30.3kDa; gap junction protein, beta 4, gap junction protein, beta 4 (connexin 30.3); gap junction beta-4 protein; connexin 30.3; CX30.3; connexin-30.3; EKV; MGC21116
• Gene ID: 127534
• mRNA Refseq: NM_153212
• Protein Refseq: NP_694944
• MIM: 605425
• UniProt ID: Q9NTQ9