Recombinant Human GINS2 protein, T7-tagged

Source :	E. coli
Species :	Human
Tag :	T7
Form :	0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence :	MASMTGGQQMGRGEFGSMDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKC RLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSAD SFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF
Purity :	>90% by SDS-PAGE
Applications :	1. May be used for mapping GINS2 protein – protein interaction assay.2. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. Potential biomarker protein for breast cancer diagnosis.4. May be used for specific antibody production.
Storage :	Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Protein length :	185 a.a.

Gene Name	GINS2 GINS complex subunit 2 (Psf2 homolog) [ Homo sapiens ]
Official Symbol	GINS2
Synonyms	GINS2; GINS complex subunit 2 (Psf2 homolog); DNA replication complex GINS protein PSF2; Pfs2; PSF2; HSPC037;
Gene ID	51659
mRNA Refseq	NM_016095
Protein Refseq	NP_057179
MIM	610609
UniProt ID	Q9Y248
Chromosome Location	16q24.1
Pathway	Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; DNA strand elongation, organism-specific biosystem; GINS complex, organism-specific biosystem; S Phase, organism-specific biosystem; Synthesis of DNA, organism-specific biosystem;
Function	protein binding;