Recombinant Human GHITM Protein, GST-tagged

• Cat.No.: GHITM-4886H
• Product Overview: Human GHITM full-length ORF ( AAH10354.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GHITM (Growth Hormone Inducible Transmembrane Protein) is a Protein Coding gene.
• Molecular Mass: 63.6 kDa
• AA Sequence: MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GHITM growth hormone inducible transmembrane protein [ Homo sapiens ]
• Official Symbol: GHITM
• Synonyms: GHITM; growth hormone inducible transmembrane protein; growth hormone-inducible transmembrane protein; DERP2; HSPC282; My021; PTD010; TMBIM5; transmembrane BAX inhibitor motif containing 5; dermal papilla-derived protein 2; mitochondrial morphology and cristae structure 1; transmembrane BAX inhibitor motif-containing protein 5; MICS1; FLJ26584; DKFZp566C0746
• Gene ID: 27069
• mRNA Refseq: NM_014394
• Protein Refseq: NP_055209
• UniProt ID: Q9H3K2