Recombinant Human GEMIN6 Protein, GST-tagged
Cat.No. : | GEMIN6-4842H |
Product Overview : | Human GEMIN6 full-length ORF ( AAH18195, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005).[supplied by OMIM |
Molecular Mass : | 44.11 kDa |
AA Sequence : | MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYDPENCSSSNEIILSRVQDLIEGHLTASQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GEMIN6 gem (nuclear organelle) associated protein 6 [ Homo sapiens ] |
Official Symbol | GEMIN6 |
Synonyms | GEMIN6; gem (nuclear organelle) associated protein 6; gem-associated protein 6; FLJ23459; SIP2; gemin 6; gemin-6; |
Gene ID | 79833 |
mRNA Refseq | NM_024775 |
Protein Refseq | NP_079051 |
MIM | 607006 |
UniProt ID | Q8WXD5 |
◆ Recombinant Proteins | ||
GEMIN6-5094C | Recombinant Chicken GEMIN6 | +Inquiry |
GEMIN6-13224H | Recombinant Human GEMIN6, GST-tagged | +Inquiry |
Gemin6-3189M | Recombinant Mouse Gemin6 Protein, Myc/DDK-tagged | +Inquiry |
GEMIN6-5311HF | Recombinant Full Length Human GEMIN6 Protein, GST-tagged | +Inquiry |
GEMIN6-6302M | Recombinant Mouse GEMIN6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GEMIN6-5960HCL | Recombinant Human GEMIN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GEMIN6 Products
Required fields are marked with *
My Review for All GEMIN6 Products
Required fields are marked with *
0
Inquiry Basket