Recombinant Human GEMIN6 Protein, GST-tagged

• Cat.No.: GEMIN6-4842H
• Product Overview: Human GEMIN6 full-length ORF ( AAH18195, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005).[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44.11 kDa
• AA Sequence: MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYDPENCSSSNEIILSRVQDLIEGHLTASQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GEMIN6 gem (nuclear organelle) associated protein 6 [ Homo sapiens ]
• Official Symbol: GEMIN6
• Synonyms: GEMIN6; gem (nuclear organelle) associated protein 6; gem-associated protein 6; FLJ23459; SIP2; gemin 6; gemin-6
• Gene ID: 79833
• mRNA Refseq: NM_024775
• Protein Refseq: NP_079051
• MIM: 607006
• UniProt ID: Q8WXD5