Recombinant Human GDF5 Protein, GST-tagged

• Cat.No.: GDF5-4827H
• Product Overview: Human GDF5 partial ORF (NP_000548.1, 28 a.a. - 127 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 28-127 a.a.
• Description: The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Mutations in this gene are associated with acromesomelic dysplasia, Hunter-Thompson type; brachydactyly, type C; and chondrodysplasia, Grebe type. These associations confirm that the gene product plays a role in skeletal development. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: APDLGQRPQGTRPGLAKAEAKERPPLARNVFRPGGHSYGGGATNANARAKGGTGQTGGLTQPKKDEPKKLPPRPGGPEPKPGHPPQTRQATARTVTPKGQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GDF5 growth differentiation factor 5 [ Homo sapiens ]
• Official Symbol: GDF5
• Synonyms: GDF5; growth differentiation factor 5; growth/differentiation factor 5; BMP14; cartilage derived morphogenetic protein 1; CDMP1; GDF-5; CDMP-1; radotermin; cartilage-derived morphogenetic protein-1; OS5; LAP4; SYNS2
• Gene ID: 8200
• mRNA Refseq: NM_000557
• Protein Refseq: NP_000548
• MIM: 601146
• UniProt ID: P43026