Recombinant Human GBX2 Protein, GST-tagged

• Cat.No.: GBX2-4784H
• Product Overview: Human GBX2 partial ORF (NP_001476.2, 141 a.a. - 230 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 141-230 a.a.
• Description: GBX2 (Gastrulation Brain Homeobox 2) is a Protein Coding gene. Diseases associated with GBX2 include Velocardiofacial Syndrome. Among its related pathways are Embryonic and Induced Pluripotent Stem Cell Differentiation Pathways and Lineage-specific Markers and Neural Crest Differentiation. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is GBX1.
• Molecular Mass: 35.53 kDa
• AA Sequence: AEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GBX2 gastrulation brain homeobox 2 [ Homo sapiens ]
• Official Symbol: GBX2
• Synonyms: GBX2; gastrulation brain homeobox 2; gastrulation brain homeo box 2; homeobox protein GBX-2; gastrulation and brain-specific homeobox protein 2
• Gene ID: 2637
• mRNA Refseq: NM_001485
• Protein Refseq: NP_001476
• MIM: 601135
• UniProt ID: P52951