Recombinant Human GBP2 protein(100-259aa), His-tagged
Cat.No. : | GBP2-3829H |
Product Overview : | Recombinant Human GBP2 protein(P32456)(100-259aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 100-259aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPD |
Gene Name | GBP2 guanylate binding protein 2, interferon-inducible [ Homo sapiens ] |
Official Symbol | GBP2 |
Synonyms | GBP2; guanylate binding protein 2, interferon-inducible; interferon-induced guanylate-binding protein 2; GBP-2; huGBP-2; GTP-binding protein 2; guanine nucleotide-binding protein 2; DKFZp451C2311; |
Gene ID | 2634 |
mRNA Refseq | NM_004120 |
Protein Refseq | NP_004111 |
MIM | 600412 |
UniProt ID | P32456 |
◆ Recombinant Proteins | ||
GBP2-3829H | Recombinant Human GBP2 protein(100-259aa), His-tagged | +Inquiry |
GBP2-4777H | Recombinant Human GBP2 Protein, GST-tagged | +Inquiry |
Gbp2-1261R | Recombinant Rat Gbp2 protein, His & T7-tagged | +Inquiry |
GBP2-13181H | Recombinant Human GBP2, GST-tagged | +Inquiry |
GBP2-1800HFL | Recombinant Full Length Human GBP2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GBP2-1337HCL | Recombinant Human GBP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GBP2 Products
Required fields are marked with *
My Review for All GBP2 Products
Required fields are marked with *
0
Inquiry Basket