Recombinant Human GBP2 protein(100-259aa), His-tagged

• Cat.No.: GBP2-3829H
• Product Overview: Recombinant Human GBP2 protein(P32456)(100-259aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 100-259aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 22.4 kDa
• AASequence: GLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: GBP2 guanylate binding protein 2, interferon-inducible [ Homo sapiens ]
• Official Symbol: GBP2
• Synonyms: GBP2; guanylate binding protein 2, interferon-inducible; interferon-induced guanylate-binding protein 2; GBP-2; huGBP-2; GTP-binding protein 2; guanine nucleotide-binding protein 2; DKFZp451C2311
• Gene ID: 2634
• mRNA Refseq: NM_004120
• Protein Refseq: NP_004111
• MIM: 600412
• UniProt ID: P32456