Recombinant Human GAS6

• Cat.No.: GAS6-28979TH
• Product Overview: Recombinant fragment of Human GAS 6 with N terminal proprietary tag, 36.63kDa inclusive of tag.

Specification

• Description: This gene product is a gamma-carboxyglutamic acid (Gla)-containing protein thought to be involved in the stimulation of cell proliferation, and may play a role in thrombosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris buffered saline
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAYKHSDITAHSCPPVEPAAA
• Tag: Non

Gene Information

• Gene Name: GAS6 growth arrest-specific 6 [ Homo sapiens ]
• Official Symbol: GAS6
• Synonyms: GAS6; growth arrest-specific 6; AXLLG; growth arrest-specific protein 6; AXL stimulatory factor; AXSF; DKFZp666G247; FLJ34709
• Gene ID: 2621
• mRNA Refseq: NM_000820
• Protein Refseq: NP_000811
• MIM: 600441
• Uniprot ID: Q14393
• Chromosome Location: 13q34
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Gamma-carboxylation of protein precursors, organism-specific biosystem; Gamma-carboxylation, transport, and amino-terminal cleavage of proteins, organism-specific biosystem; Hemostasis, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem
• Function: calcium ion binding; receptor agonist activity; receptor binding