Recombinant Human GAPT Protein, GST-tagged

• Cat.No.: GAPT-4727H
• Product Overview: Human GAPT full-length ORF (BAC03557.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GAPT (GRB2 Binding Adaptor Protein, Transmembrane) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44.3 kDa
• AA Sequence: MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLRHEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPRPSEVPQDEDIYILPDSY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GAPT GRB2-binding adaptor protein, transmembrane [ Homo sapiens ]
• Official Symbol: GAPT
• Synonyms: C5orf29; GAPT; GRB2-binding adaptor protein, transmembrane
• Gene ID: 202309
• mRNA Refseq: NM_152687
• Protein Refseq: NP_689900
• UniProt ID: Q8N292