Recombinant Human GALM Protein, GST-tagged

• Cat.No.: GALM-4685H
• Product Overview: Human GALM full-length ORF ( NP_620156.1, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 64.2 kDa
• AA Sequence: MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GALM galactose mutarotase (aldose 1-epimerase) [ Homo sapiens ]
• Official Symbol: GALM
• Synonyms: GALM; galactose mutarotase (aldose 1-epimerase); aldose 1-epimerase; aldose 1 epimerase; galactomutarotase; IBD1; BLOCK25
• Gene ID: 130589
• mRNA Refseq: NM_138801
• Protein Refseq: NP_620156
• MIM: 608883
• UniProt ID: Q96C23