Recombinant Human GALK2, His-tagged
Cat.No. : | GALK2-28969TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 265-445 of Human GALK2 with N terminal His tag; 191 amino acids, 22kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 265-445 a.a. |
Description : | This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 114 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLG ISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVL QFKKICEEAPENMVQLLGELMNQSHMSCRDMYECSCPELD QLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFL ANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLL |
Gene Name | GALK2 galactokinase 2 [ Homo sapiens ] |
Official Symbol | GALK2 |
Synonyms | GALK2; galactokinase 2; N-acetylgalactosamine kinase; GK2; |
Gene ID | 2585 |
mRNA Refseq | NM_001001556 |
Protein Refseq | NP_001001556 |
MIM | 137028 |
Uniprot ID | Q01415 |
Chromosome Location | 15 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | ATP binding; N-acetylgalactosamine kinase activity; galactokinase activity; galactokinase activity; kinase activity; |
◆ Recombinant Proteins | ||
HA-1167V | Recombinant Influenza B (B/Massachusetts/03/2010) HA protein(Met1-Leu585) | +Inquiry |
CHK1-3899H | Recombinant Human CHK1 protein, His-tagged | +Inquiry |
btuD-4354H | Recombinant Halobacterium salinarum btuD protein, His-tagged | +Inquiry |
TFB2M-6345Z | Recombinant Zebrafish TFB2M | +Inquiry |
MKRN2-3603H | Recombinant Human MKRN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Fibrinogen-71R | Active Native Rabbit Fibrinogen | +Inquiry |
CTRC-1209B | Native Bovine Chymotrypsin C (Caldecrin) | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
Tnnt3-7424M | Native Mouse Tnnt3 Protein | +Inquiry |
Ren -72R | Recombinant Rat Prorenin, His tag | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFSD2A-1086HCL | Recombinant Human MFSD2A cell lysate | +Inquiry |
C1QTNF3-8137HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
CECR1-001HCL | Recombinant Human CECR1 cell lysate | +Inquiry |
HIST1H4A-5527HCL | Recombinant Human HIST1H4A 293 Cell Lysate | +Inquiry |
Occipital lobe-346H | Human Occipital lobe (Alzheimers Disease) Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALK2 Products
Required fields are marked with *
My Review for All GALK2 Products
Required fields are marked with *
0
Inquiry Basket