Recombinant Human GALK2, His-tagged

Cat.No. : GALK2-28969TH
Product Overview : Recombinant fragment, corresponding to amino acids 265-445 of Human GALK2 with N terminal His tag; 191 amino acids, 22kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
ProteinLength : 265-445 a.a.
Description : This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 114 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLG ISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVL QFKKICEEAPENMVQLLGELMNQSHMSCRDMYECSCPELD QLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFL ANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLL
Gene Name GALK2 galactokinase 2 [ Homo sapiens ]
Official Symbol GALK2
Synonyms GALK2; galactokinase 2; N-acetylgalactosamine kinase; GK2;
Gene ID 2585
mRNA Refseq NM_001001556
Protein Refseq NP_001001556
MIM 137028
Uniprot ID Q01415
Chromosome Location 15
Pathway Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function ATP binding; N-acetylgalactosamine kinase activity; galactokinase activity; galactokinase activity; kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GALK2 Products

Required fields are marked with *

My Review for All GALK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon