Recombinant Human GADD45GIP1, His-tagged

Cat.No. : GADD45GIP1-26074TH
Product Overview : Recombinant fragment of Human GADD45GIP1 with a N terminal His tag; 196 amino acids with a predicted MWt 22.6 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 175 amino acids
Description : GADD45GIP1, also known as CRIF1, is a nuclear protein that plays a role in apoptosis control. This protein is expressed in a variety of tissues, including heart, thyroid, trachea, kidney, ovary, pancreas, testis and stomach.
Conjugation : HIS
Molecular Weight : 22.600kDa inclusive of tags
Tissue specificity : Widely expressed. Highly expressed in the thyroid gland, heart, lymph nodes, trachea and adrenal tissues. Expressed at lower level in liver skeletal muscle, kidney, pancreas, testis, ovary and stomach. Barely detectable in adrenal adenoma and papillary th
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.03% DTT, 1.17% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMPRWQLGPRYAAKQFARYGA ASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVK QLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKA QADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKE RKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Gene Name GADD45GIP1 growth arrest and DNA-damage-inducible, gamma interacting protein 1 [ Homo sapiens ]
Official Symbol GADD45GIP1
Synonyms GADD45GIP1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; growth arrest and DNA damage-inducible proteins-interacting protein 1; CKBBP2; CKII beta binding protein 2; CR6 interacting factor 1; CRIF1; MGC4667; MGC4758; p53 responsive
Gene ID 90480
mRNA Refseq NM_052850
Protein Refseq NP_443082
MIM 605162
Uniprot ID Q8TAE8
Chromosome Location 19p13.2
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GADD45GIP1 Products

Required fields are marked with *

My Review for All GADD45GIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon