Recombinant Human GABPB1

Cat.No. : GABPB1-27461TH
Product Overview : Recombinant fragment of Human GABPB2, isoform 3 with N-terminal proprietary tag. Predicted MW 35.20kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 87 amino acids
Description : This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Molecular Weight : 35.200kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TIVTDGIQLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEVRSLLPGVLCRSHPK
Sequence Similarities : Contains 5 ANK repeats.
Gene Name GABPB1 GA binding protein transcription factor, beta subunit 1 [ Homo sapiens ]
Official Symbol GABPB1
Synonyms GABPB1; GA binding protein transcription factor, beta subunit 1; GA binding protein transcription factor, beta subunit 2 , GABPB2; GA-binding protein subunit beta-1; E4TF1 47; GABPB;
Gene ID 2553
mRNA Refseq NM_002041
Protein Refseq NP_002032
MIM 600610
Uniprot ID Q06547
Chromosome Location 15q21.2
Pathway Myometrial Relaxation and Contraction Pathways, organism-specific biosystem;
Function protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GABPB1 Products

Required fields are marked with *

My Review for All GABPB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon