Recombinant Human FZD6 Protein, GST-tagged

• Cat.No.: FZD6-4597H
• Product Overview: Human FZD6 partial ORF ( NP_003497, 71 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene represents a member of the frizzled gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The protein encoded by this family member contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, and seven transmembrane domains, but unlike other family members, this protein does not contain a C-terminal PDZ domain-binding motif. This protein functions as a negative regulator of the canonical Wnt/beta-catenin signaling cascade, thereby inhibiting the processes that trigger oncogenic transformation, cell proliferation, and inhibition of apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.95 kDa
• AA Sequence: PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FZD6 frizzled family receptor 6 [ Homo sapiens ]
• Official Symbol: FZD6
• Synonyms: FZD6; frizzled family receptor 6; frizzled (Drosophila) homolog 6, frizzled 6, seven transmembrane spanning receptor, frizzled homolog 6 (Drosophila); frizzled-6; Hfz6; frizzled homolog 6; seven transmembrane helix receptor; frizzled 6, seven transmembrane spanning receptor; FZ6; FZ-6; HFZ6; NDNC10
• Gene ID: 8323
• mRNA Refseq: NM_001164615
• Protein Refseq: NP_001158087
• MIM: 603409
• UniProt ID: O60353