Recombinant Human FZD3 Protein, GST-tagged

• Cat.No.: FZD3-12H
• Product Overview: Recombinant Human FZD3(55 a.a. - 157 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.07kDa
• Protein length: 55 a.a. - 157 a.a.
• AA Sequence: QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: FZD3 frizzled family receptor 3 [ Homo sapiens ]
• Official Symbol: FZD3
• Synonyms: FZD3; frizzled family receptor 3; frizzled (Drosophila) homolog 3 , frizzled 3, seven transmembrane spanning receptor , frizzled homolog 3 (Drosophila); frizzled-3; frizzled homolog 3; frizzled 3, seven transmembrane spanning receptor; Fz-3
• Gene ID: 7976
• mRNA Refseq: NM_017412
• Protein Refseq: NP_059108
• MIM: 606143
• UniProt ID: Q9NPG1