Recombinant Human FYTTD1 Protein, GST-tagged

Cat.No. : FYTTD1-4588H
Product Overview : Human FYTTD1 full-length ORF ( NP_115664.2, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FYTTD1 (Forty-Two-Three Domain Containing 1) is a Protein Coding gene. Among its related pathways are Gene Expression and Transport of Mature Transcript to Cytoplasm. GO annotations related to this gene include poly(A) RNA binding and mRNA binding.
Molecular Mass : 62.2 kDa
AA Sequence : MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNFPRLNRRLLQQSGAQQFRMRVRWGIQQNSGFGKTSLNRRGRVMPGKRRPNGVITGLAARKTTGIRKGISPMNRPPLSDKNIEQYFPVLKRKANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLDDVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRLTRTAVPSFLTKREQSDVKKVPKGVPLQFDINSVGKQTGMTLNERFGILKEQRATLTYNKGGSRFVTVG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FYTTD1 forty-two-three domain containing 1 [ Homo sapiens ]
Official Symbol FYTTD1
Synonyms FYTTD1; forty-two-three domain containing 1; UAP56-interacting factor; DKFZp761B1514; UAP56 interacting factor; UIF; protein 40-2-3; forty-two-three domain-containing protein 1;
Gene ID 84248
mRNA Refseq NM_001011537
Protein Refseq NP_001011537
MIM 616933
UniProt ID Q96QD9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FYTTD1 Products

Required fields are marked with *

My Review for All FYTTD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon