Recombinant Human FXYD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FXYD2-3531H
• Product Overview: FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_067614) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.
• Molecular Mass: 7.4 kDa
• AA Sequence: MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FXYD2 FXYD domain containing ion transport regulator 2 [ Homo sapiens (human) ]
• Official Symbol: FXYD2
• Synonyms: FXYD2; FXYD domain containing ion transport regulator 2; ATP1G1, HOMG2, hypomagnesemia 2, renal; sodium/potassium-transporting ATPase subunit gamma; MGC12372; sodium pump gamma chain; Na(+)/K(+) ATPase subunit gamma; ATPase, Na+/K+ transporting, gamma 1 polypeptide; HOMG2; ATP1G1
• Gene ID: 486
• mRNA Refseq: NM_021603
• Protein Refseq: NP_067614
• MIM: 601814
• UniProt ID: P54710