Recombinant Human FUT8 protein, His-tagged

• Cat.No.: FUT8-518H
• Product Overview: Recombinant Human FUT8 protein(NP_004471)(276-575 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 276-575 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: HWSGEVKDKNVQVVEFPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FUT8 fucosyltransferase 8 (alpha (1,6) fucosyltransferase) [ Homo sapiens ]
• Official Symbol: FUT8
• Synonyms: FUT8; fucosyltransferase 8 (alpha (1,6) fucosyltransferase); alpha-(1,6)-fucosyltransferase; alpha1-6FucT; glycoprotein 6-alpha-L-fucosyltransferase; GDP-fucose--glycoprotein fucosyltransferase; GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase; MGC26465
• Gene ID: 2530
• mRNA Refseq: NM_004480
• Protein Refseq: NP_004471
• MIM: 602589
• UniProt ID: Q9BYC5