Recombinant Human FUT4 Protein, GST-tagged

• Cat.No.: FUT4-4563H
• Product Overview: Human FUT4 partial ORF ( NP_002024.1, 167 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The product of this gene transfers fucose to N-acetyllactosamine polysaccharides to generate fucosylated carbohydrate structures. It catalyzes the synthesis of the non-sialylated antigen, Lewis x (CD15). [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: ITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FUT4 fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific) [ Homo sapiens ]
• Official Symbol: FUT4
• Synonyms: FUT4; fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific); CD15, ELFT, FCT3A; alpha-(1,3)-fucosyltransferase; ELAM ligand fucosyltransferase; FUC TIV; galactoside 3 L fucosyltransferase; Lewis X; fucT-IV; fucosyltransferase IV; ELAM-1 ligand fucosyltransferase; galactoside 3-L-fucosyltransferase; stage-specific embryonic antigen 1; LeX; CD15; ELFT; FCT3A; FUTIV; SSEA-1; FUC-TIV
• Gene ID: 2526
• mRNA Refseq: NM_002033
• Protein Refseq: NP_002024
• MIM: 104230
• UniProt ID: P22083