Recombinant Human FUT2 Protein (AA 34-343), N-6×His/GFP tagged

• Cat.No.: FUT2-26H
• Product Overview: Recombinant Human FUT2 Protein (AA 34-343) with N-6×His/GFP tag was expressed in HEK293.

Specification

• Description: This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. The encoded protein is important for the final step in the soluble ABO blood group antigen synthesis pathway. It is also involved in cell-cell interaction, cell surface expression, and cell proliferation. Mutations in this gene are a cause of the H-Bombay blood group where red blood cells lack the H antigen.
• Source: HEK293
• Species: Human
• Tag: His&GFP
• Molecular Mass: 65-70 kDa
• Protein length: AA 34-343
• AA Sequence: KIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHFPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH
• Purity: >95%, by SDS-PAGE as visualized by Coomassie Blue Staining
• Stability: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
• Preservative: 0.05 % NaN3
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: FUT2 fucosyltransferase 2 (secretor status included) [ Homo sapiens (human) ]
• Official Symbol: FUT2
• Synonyms: FUT2; fucosyltransferase 2 (secretor status included); SE; galactoside 2-alpha-L-fucosyltransferase 2; alpha (1; 2) fucosyltransferase; alpha(1; 2)FT2; galactoside 2 alpha L fucosyltransferase 2; GDP L fucose:beta D galactoside 2 alpha L fucosyltransferase 2; Se2; SEC2; secretor blood group alpha 2 fucosyltransferase; secretor factor; sej; alpha(1,2)FT2; alpha(1,2)FT 2; alpha (1,2) fucosyltransferase; secretor blood group alpha-2-fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2; B12QTL1
• Gene ID: 2524
• mRNA Refseq: NM_000511
• Protein Refseq: NP_000502
• MIM: 182100
• UniProt ID: Q10981