Recombinant Human FUS protein, GST-tagged
Cat.No. : | FUS-301394H |
Product Overview : | Recombinant Human FUS (52-400 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gln52-Gly400 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | QSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | FUS fused in sarcoma [ Homo sapiens ] |
Official Symbol | FUS |
Synonyms | FUS; fused in sarcoma; ALS6, amyotrophic lateral sclerosis 6 , fusion (involved in t(12;16) in malignant liposarcoma) , fusion, derived from t(12;16) malignant liposarcoma; RNA-binding protein FUS; FUS1; heterogeneous nuclear ribonucleoprotein P2; hnRNP P2; TLS; translocated in liposarcoma; oncogene FUS; oncogene TLS; fus-like protein; 75 kDa DNA-pairing protein; fusion gene in myxoid liposarcoma; translocated in liposarcoma protein; ALS6; POMP75; HNRNPP2; |
Gene ID | 2521 |
mRNA Refseq | NM_001170634 |
Protein Refseq | NP_001164105 |
MIM | 137070 |
UniProt ID | P35637 |
◆ Recombinant Proteins | ||
FUS-3391M | Recombinant Mouse FUS Protein, His (Fc)-Avi-tagged | +Inquiry |
FUS-1121C | Recombinant Chicken FUS | +Inquiry |
FUS-06H | Active Recombinant Human FUS Protein, Myc/DDK-tagged | +Inquiry |
FUS-30143TH | Recombinant Human FUS, His-tagged | +Inquiry |
FUS-11307Z | Recombinant Zebrafish FUS | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUS-6118HCL | Recombinant Human FUS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FUS Products
Required fields are marked with *
My Review for All FUS Products
Required fields are marked with *
0
Inquiry Basket