Recombinant Human FUOM Protein, GST-tagged

Cat.No. : FUOM-418H
Product Overview : Human C10orf125 full-length ORF (BAC85178.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 41 kDa
AA Sequence : MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESPAAVMEPVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGC
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FUOM fucose mutarotase [ Homo sapiens ]
Official Symbol FUOM
Synonyms FUCU; FucM; C10orf125
Gene ID 282969
mRNA Refseq NM_198472.2
Protein Refseq NP_940874.2
UniProt ID A2VDF0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FUOM Products

Required fields are marked with *

My Review for All FUOM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon