Recombinant Human FTMT Protein, GST-tagged

• Cat.No.: FTMT-4534H
• Product Overview: Human FTMT partial ORF ( NP_803431.1, 143 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FTMT (Ferritin Mitochondrial) is a Protein Coding gene. Diseases associated with FTMT include Friedreich Ataxia and Restless Legs Syndrome. Among its related pathways are Ferroptosis. GO annotations related to this gene include ferric iron binding and ferroxidase activity. An important paralog of this gene is FTH1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: QDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FTMT ferritin mitochondrial [ Homo sapiens (human) ]
• Official Symbol: FTMT
• Synonyms: FTMT; ferritin mitochondrial; MTF; ferritin, mitochondrial; ferritin H subunit; mitochondrial ferritin; EC 1.16.3.1; Ferritin Mitochondrial; Ferritin, Mitochondrial; Mitochondrial Ferritin; Ferritin H Subunit
• Gene ID: 94033
• mRNA Refseq: NM_177478
• Protein Refseq: NP_803431
• MIM: 608847
• UniProt ID: Q8N4E7