Recombinant Human FTMT Protein, GST-tagged
Cat.No. : | FTMT-4534H |
Product Overview : | Human FTMT partial ORF ( NP_803431.1, 143 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FTMT (Ferritin Mitochondrial) is a Protein Coding gene. Diseases associated with FTMT include Friedreich Ataxia and Restless Legs Syndrome. Among its related pathways are Ferroptosis. GO annotations related to this gene include ferric iron binding and ferroxidase activity. An important paralog of this gene is FTH1. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FTMT ferritin mitochondrial [ Homo sapiens (human) ] |
Official Symbol | FTMT |
Synonyms | FTMT; ferritin mitochondrial; MTF; ferritin, mitochondrial; ferritin H subunit; mitochondrial ferritin; EC 1.16.3.1; Ferritin Mitochondrial; Ferritin, Mitochondrial; Mitochondrial Ferritin; Ferritin H Subunit |
Gene ID | 94033 |
mRNA Refseq | NM_177478 |
Protein Refseq | NP_803431 |
MIM | 608847 |
UniProt ID | Q8N4E7 |
◆ Recombinant Proteins | ||
FTMT-6072M | Recombinant Mouse FTMT Protein | +Inquiry |
FTMT-5543H | Recombinant Human FTMT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FTMT-3699H | Recombinant Human FTMT Protein (Leu49-Asn242), His tagged | +Inquiry |
FTMT-1528H | Recombinant Human FTMT Protein, His-tagged | +Inquiry |
Ftmt-7959R | Recombinant Rat Ftmt protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTMT-6125HCL | Recombinant Human FTMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FTMT Products
Required fields are marked with *
My Review for All FTMT Products
Required fields are marked with *
0
Inquiry Basket