Recombinant Human FSHR Protein, His-tagged
Cat.No. : | FSHR-24H |
Product Overview : | Recombinant Human FSHR Protein (18-366 aa) is produced by Mammalian cell expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
Availability | April 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 18-366 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 43.5 kDa |
AA Sequence : | CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | FSHR follicle stimulating hormone receptor [ Homo sapiens ] |
Official Symbol | FSHR |
Synonyms | FSHR; ODG1; FSHRO; LGR1; FSH receptor; follitropin receptor; MGC141667; MGC141668; |
Gene ID | 2492 |
mRNA Refseq | NM_000145 |
Protein Refseq | NP_000136 |
MIM | 136435 |
UniProt ID | P23945 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FSHR Products
Required fields are marked with *
My Review for All FSHR Products
Required fields are marked with *
0
Inquiry Basket