Recombinant Human FPR3 Protein, GST-tagged

• Cat.No.: FPR3-4489H
• Product Overview: Human FPR3 partial ORF (NP_002021.3, 254 a.a. - 353 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 254-353 a.a.
• Description: FPR3 (Formyl Peptide Receptor 3) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Integrin Pathway. GO annotations related to this gene include G-protein coupled receptor activity and N-formyl peptide receptor activity. An important paralog of this gene is FPR2.
• Molecular Mass: 36.63 kDa
• AA Sequence: WFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPILYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FPR3 formyl peptide receptor 3 [ Homo sapiens ]
• Official Symbol: FPR3
• Synonyms: FPR3; formyl peptide receptor 3; formyl peptide receptor like 2, FPRL2; N-formyl peptide receptor 3; FMLPY; FPRH1; RMLP R I; FMLP-R-II; FMLP-related receptor II; formyl peptide receptor-like 2; FPRH2; FPRL2; RMLP-R-I; FML2_HUMAN
• Gene ID: 2359
• mRNA Refseq: NM_002030
• Protein Refseq: NP_002021
• MIM: 136539
• UniProt ID: P25089