Recombinant Human FPR2

• Cat.No.: FPR2-28948TH
• Product Overview: Recombinant fragment corresponding to amino acids 163-205 of Human FPRL1 with an N terminal proprietary tag; Predicted MWt 30.36 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 43 amino acids
• Description: N-formyl peptide receptor 2 is a protein that in humans is encoded by the FPR2 gene.
• Molecular Weight: 30.360kDa inclusive of tags
• Tissue specificity: Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.

Gene Information

• Gene Name: FPR2 formyl peptide receptor 2 [ Homo sapiens ]
• Official Symbol: FPR2
• Synonyms: FPR2; formyl peptide receptor 2; formyl peptide receptor like 1 , FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R
• Gene ID: 2358
• mRNA Refseq: NM_001005738
• Protein Refseq: NP_001005738
• MIM: 136538
• Uniprot ID: P25090
• Chromosome Location: 19q13.3-q13.4
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Formyl peptide receptors bind formyl peptides and many other ligands, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem
• Function: G-protein coupled receptor activity; N-formyl peptide receptor activity; receptor activity; signal transducer activity