Recombinant Human FOXI2 Protein, GST-tagged

• Cat.No.: FOXI2-4455H
• Product Overview: Human FOXI2 full-length ORF (BAC87649.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FOXI2 (Forkhead Box I2) is a Protein Coding gene. Diseases associated with FOXI2 include Mental Retardation-Hypotonic Facies Syndrome, X-Linked. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is FOXI1.
• Molecular Mass: 40 kDa
• AA Sequence: MFDNGNFRRKRKRRAEASAAVRSGARSVGGAEAPALEPPSAACLDLQASPSPSAPEAATCFSGFASAMSALAGGLGTFPGGLAGDFSFGRRPPTVATHAPQTLNPSPGFAPGHQTAAAGFRLSHLLYSREGTEV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXI2 forkhead box I2 [ Homo sapiens ]
• Official Symbol: FOXI2
• Synonyms: FOXI2; forkhead box I2; forkhead box protein I2; FLJ46831; homolog of mouse Foxi2
• Gene ID: 399823
• mRNA Refseq: NM_207426
• Protein Refseq: NP_997309
• MIM: 617202
• UniProt ID: Q6ZQN5