Recombinant Human FOXD4L4 Protein, GST-tagged

• Cat.No.: FOXD4L4-4445H
• Product Overview: Human FOXD4L4 partial ORF ( NP_954714.2, 317 a.a. - 416 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FOXD4L4 (Forkhead Box D4-Like 4) is a Protein Coding gene. Diseases associated with FOXD4L4 include Leukemia, Acute Myeloid. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is FOXD4L5.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: HREADASLSALRVLCKGSGERVQGLRRVCPRPRGATATCSSDHQACCIPKPLPLCCKCPPPLLLGQFCSNSSSIRRTAPTAALPPRARCWAGTCRPRRRC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXD4L4 forkhead box D4 like 4 [ Homo sapiens (human) ]
• Official Symbol: FOXD4L4
• Synonyms: FOXD4L4; forkhead box D4 like 4; FOXD4b; FOXD4L2; bA460E7.2; forkhead box protein D4-like 4; FOXD4-like 4; forkhead box D4-like 2; forkhead box protein D4-like 2; forkhead box protein D4b; myeloid factor-gamma; winged helix factor-1; winged helix transcription factor beta
• Gene ID: 349334
• mRNA Refseq: NM_199244
• Protein Refseq: NP_954714
• MIM: 611085
• UniProt ID: Q8WXT5