Recombinant Human FOXC2 Protein, GST-tagged
Cat.No. : | FOXC2-4438H |
Product Overview : | Human FOXC2 full-length ORF ( AAI11590.1, 1 a.a. - 501 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. [provided by RefSeq |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 82.06 kDa |
AA Sequence : | MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYHHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXC2 forkhead box C2 (MFH-1, mesenchyme forkhead 1) [ Homo sapiens ] |
Official Symbol | FOXC2 |
Synonyms | FOXC2; forkhead box C2 (MFH-1, mesenchyme forkhead 1); FKHL14; forkhead box protein C2; MFH 1; MFH-1,mesenchyme forkhead 1; transcription factor FKH-14; mesenchyme fork head protein 1; forkhead-related protein FKHL14; forkhead, Drosophila, homolog-like 14; LD; MFH1; MFH-1; |
Gene ID | 2303 |
mRNA Refseq | NM_005251 |
Protein Refseq | NP_005242 |
MIM | 602402 |
UniProt ID | Q99958 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FOXC2 Products
Required fields are marked with *
My Review for All FOXC2 Products
Required fields are marked with *
0
Inquiry Basket