Recombinant Human FNDC5, StrepII-tagged

• Cat.No.: FNDC5-253H
• Product Overview: Purified, full-length human recombinant FNDC5 or Irisin protein (amino acids 16-196, 181 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 12.6 kDa. (Accession NP_715637.1; UniProt Q8NAU1)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 16-196, 181 a.a.
• Description: FNDC5 (Irisin) mediates beneficial effects of muscular exercise. It induces browning of white adipose tissue by stimulating UCP1 expression, at least in part, via the nuclear receptor PPARA By similarity. The extracellular domain is cleaved and released from the cell membrane.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFK TPREAEKMASKNKDEVTMKE
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: FNDC5 fibronectin type III domain containing 5 [ Homo sapiens ]
• Official Symbol: FNDC5
• Synonyms: FNDC5; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; FRCP2; fibronectin type III repeat-containing protein 2
• Gene ID: 252995
• mRNA Refseq: NM_001171940
• Protein Refseq: NP_001165411
• MIM: 611906
• UniProt ID: Q8NAU1
• Chromosome Location: 1p34.3
• Function: hormone activity