Recombinant Human FNDC5 Protein, GST-tagged

• Cat.No.: FNDC5-4410H
• Product Overview: Human FNDC5 full-length ORF ( NP_715637.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a secreted protein that is released from muscle cells during exercise. The encoded protein may participate in the development of brown fat. Translation of the precursor protein initiates at a non-AUG start codon at a position that is conserved as an AUG start codon in other organisms. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]
• Molecular Mass: 41.9 kDa
• AA Sequence: MLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FNDC5 fibronectin type III domain containing 5 [ Homo sapiens ]
• Official Symbol: FNDC5
• Synonyms: FNDC5; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; FRCP2; fibronectin type III repeat-containing protein 2
• Gene ID: 252995
• mRNA Refseq: NM_001171940
• Protein Refseq: NP_001165411
• MIM: 611906
• UniProt ID: Q8NAU1