Recombinant Human FMO4 Protein, GST-tagged

• Cat.No.: FMO4-4393H
• Product Overview: Human FMO4 partial ORF ( NP_002013.1, 206 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. [provided by RefSeq
• Molecular Mass: 36.3 kDa
• AA Sequence: TAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKTS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FMO4 flavin containing monooxygenase 4 [ Homo sapiens ]
• Official Symbol: FMO4
• Synonyms: FMO4; flavin containing monooxygenase 4; FMO2; dimethylaniline monooxygenase [N-oxide-forming] 4; FMO 4; dimethylaniline oxidase 4; hepatic flavin-containing monooxygenase 4
• Gene ID: 2329
• mRNA Refseq: NM_002022
• Protein Refseq: NP_002013
• MIM: 136131
• UniProt ID: P31512