Recombinant Human FLVCR2 protein, GST-tagged

• Cat.No.: FLVCR2-301269H
• Product Overview: Recombinant Human FLVCR2 (476-526 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Phe476-Leu526
• AA Sequence: FLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: FLVCR2 feline leukemia virus subgroup C cellular receptor family, member 2 [ Homo sapiens ]
• Official Symbol: FLVCR2
• Synonyms: FLVCR2; feline leukemia virus subgroup C cellular receptor family, member 2; C14orf58, chromosome 14 open reading frame 58 , feline leukemia virus subgroup C cellular receptor 2; feline leukemia virus subgroup C receptor-related protein 2; FLJ20371; MFSD7C; calcium-chelate transporter; CCT; EPV; PVHH; C14orf58; FLVCRL14q
• Gene ID: 55640
• mRNA Refseq: NM_017791
• Protein Refseq: NP_060261
• MIM: 610865
• UniProt ID: Q9UPI3