Recombinant Human FLT4 Protein, GST-tagged

• Cat.No.: FLT4-4379H
• Product Overview: Human FLT4 partial ORF ( NP_002011, 34 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FLT4 fms-related tyrosine kinase 4 [ Homo sapiens ]
• Official Symbol: FLT4
• Synonyms: FLT4; fms-related tyrosine kinase 4; vascular endothelial growth factor receptor 3; PCL; VEGFR3; FLT-4; VEGFR-3; soluble VEGFR3 variant 1; soluble VEGFR3 variant 2; soluble VEGFR3 variant 3; fms-like tyrosine kinase 4; tyrosine-protein kinase receptor FLT4; FLT41; LMPH1A
• Gene ID: 2324
• mRNA Refseq: NM_002020
• Protein Refseq: NP_002011
• MIM: 136352
• UniProt ID: P35916