Recombinant Human FLT3 Protein, GMP Grade, Animal-Free

Cat.No. : FLT3-29HG
Product Overview : GMP Recombinant Human FLT3 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Flt3-Ligand is a growth factor that regulates proliferation of early hematopoietic cells. Flt3-Ligand binds to cells expressing the tyrosine kinase receptor Flt3. Flt3-Ligand, by itself does not stimulate proliferation of early hematopoietic cells, but synergizes with other CSFs and interleukins to induce growth and differentiation. Unlike SCF, Flt3-Ligand exerts no activity on mast cells. Multiple isoforms of Flt3-Ligand have been identified. The predominant biologically active form is anchored to the cell surface as the extracellular domain of a transmembrane protein (209 a.a.). The membrane-bound isoform can be proteolytically cleaved to generate a biologically active soluble isoform.
AA Sequence : MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Gene Name FLT3 fms-related tyrosine kinase 3 [ Homo sapiens (human) ]
Official Symbol FLT3
Synonyms FLT3; fms-related tyrosine kinase 3; receptor-type tyrosine-protein kinase FLT3; CD135; FLK2; STK1; STK-1; CD135 antigen; FL cytokine receptor; fetal liver kinase 2; fms-like tyrosine kinase 3; stem cell tyrosine kinase 1; growth factor receptor tyrosine kinase type III; FLK-2;
Gene ID 2322
mRNA Refseq NM_004119
Protein Refseq NP_004110
MIM 136351
UniProt ID P36888

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FLT3 Products

Required fields are marked with *

My Review for All FLT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon