Recombinant Human FLRT1 Protein, GST-tagged
Cat.No. : | FLRT1-4364H |
Product Overview : | Human FLRT1 full-length ORF ( AAH18370, 1 a.a. - 674 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the fibronectin leucine rich transmembrane protein (FLRT) family. The family members may function in cell adhesion and/or receptor signalling. Their protein structures resemble small leucine-rich proteoglycans found in the extracellular matrix. The encoded protein shares sequence similarity with two other family members, FLRT2 and FLRT3. This gene is expressed in kidney and brain. [provided by RefSeq |
Molecular Mass : | 99.88 kDa |
AA Sequence : | MVVAHPTATATTTPTATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLPLAGIIGGAVALVFLFLVLGAICWYVHQAGELLTRERAYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTTRGYRDGGIPDIDYSYT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FLRT1 fibronectin leucine rich transmembrane protein 1 [ Homo sapiens ] |
Official Symbol | FLRT1 |
Synonyms | FLRT1; fibronectin leucine rich transmembrane protein 1; leucine-rich repeat transmembrane protein FLRT1; MGC21624; fibronectin-like domain-containing leucine-rich transmembrane protein 1; |
Gene ID | 23769 |
mRNA Refseq | NM_013280 |
Protein Refseq | NP_037412 |
MIM | 604806 |
UniProt ID | Q9NZU1 |
◆ Recombinant Proteins | ||
FLRT1-3494H | Recombinant Human FLRT1 Protein (Ile21-Pro524), C-His tagged | +Inquiry |
Flrt1-1730M | Recombinant Mouse Flrt1 protein, His & T7-tagged | +Inquiry |
FLRT1-12934H | Recombinant Human FLRT1, GST-tagged | +Inquiry |
FLRT1-164H | Recombinant Human FLRT1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
FLRT1-1729H | Recombinant Human FLRT1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLRT1-1958HCL | Recombinant Human FLRT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLRT1 Products
Required fields are marked with *
My Review for All FLRT1 Products
Required fields are marked with *
0
Inquiry Basket