Recombinant Human FLOT2 protein, T7/His-tagged
Cat.No. : | FLOT2-220H |
Product Overview : | Recombinant human FLOT2 cDNA (427 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISL EIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQ IYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAEC KKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEA QEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEATVIEAMGKAEAERMKLKAEA YQKYGDAAKMALVLEALPQIAAKIAAPLPVPSGKIKNS |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | FLOT2 flotillin 2 [ Homo sapiens ] |
Official Symbol | FLOT2 |
Synonyms | FLOT2; flotillin 2; M17S1; flotillin-2; ECS 1; ECS1; ESA; ESA1; epidermal surface antigen; membrane component chromosome 17 surface marker 1; ECS-1; |
Gene ID | 2319 |
mRNA Refseq | NM_004475 |
Protein Refseq | NP_004466 |
MIM | 131560 |
UniProt ID | Q14254 |
Chromosome Location | 17q11-q12 |
Pathway | Insulin Signaling, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem; |
◆ Recombinant Proteins | ||
FLOT2-1506H | Recombinant Human FLOT2 Protein, His-tagged | +Inquiry |
Flot2-3040M | Recombinant Mouse Flot2 Protein, Myc/DDK-tagged | +Inquiry |
FLOT2-1555HFL | Recombinant Full Length Human FLOT2 Protein, C-Flag-tagged | +Inquiry |
FLOT2-5924M | Recombinant Mouse FLOT2 Protein | +Inquiry |
FLOT2-2362R | Recombinant Rat FLOT2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLOT2-6185HCL | Recombinant Human FLOT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLOT2 Products
Required fields are marked with *
My Review for All FLOT2 Products
Required fields are marked with *
0
Inquiry Basket